PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0351s0200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family WOX
Protein Properties Length: 297aa    MW: 33612.5 Da    PI: 9.118
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0351s0200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.47e-2058119157
                             TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                Homeobox   1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                             r +R+++t+ ql +Lee ++   r+p+++++++++++l    +++ ++V++WFqN++a+e+k
  SapurV1A.0351s0200.1.p  58 RNSRWNPTAAQLLALEEKYRCgIRTPTTDQIQQITSQLrrfgKIEGKNVFYWFQNHKARERK 119
                             689*****************99**************************************98 PP

2Wus_type_Homeobox103.71.3e-3359120364
       Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                             ++RW+Pt+ Q+  Lee y++G+rtP++++iq+it++L+++Gkie+kNVfyWFQN+kaRer++
  SapurV1A.0351s0200.1.p  59 NSRWNPTAAQLLALEEKYRCGIRTPTTDQIQQITSQLRRFGKIEGKNVFYWFQNHKARERKQ 120
                             79**********************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.80755120IPR001356Homeobox domain
SuperFamilySSF466898.98E-1156125IPR009057Homeodomain-like
SMARTSM003897.3E-557124IPR001356Homeobox domain
PfamPF000461.6E-1758119IPR001356Homeobox domain
CDDcd000860.00258115No hitNo description
Gene3DG3DSA:1.10.10.601.1E-760120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MRMINGGDNN EPRMDDFFNP KPNTAATSLT YVGLKHHLGK TSEQSRGGKL KEQAEETRNS  60
RWNPTAAQLL ALEEKYRCGI RTPTTDQIQQ ITSQLRRFGK IEGKNVFYWF QNHKARERKQ  120
RRRRQVQQKH SNSTGHESLN TLKETGPRRT FLELDQTNNL VPHYSNCSTD HVEGPVSVNG  180
PAIAESGTYG WPEFQERELQ EMKSSSLGMH AVWKNMDLSS STPVRHHLST SAVNTAASKF  240
LSLEEHISLL KPAKTTAHAN HDDEIREIQT LQLFPLCSDD GNGANGQFFE FLPLKN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827070.0KF982707.1 Populus tomentosa WOX6 (WOX6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314802.11e-162hypothetical protein POPTR_0010s12150g
TrEMBLB9HW561e-162B9HW56_POPTR; Uncharacterized protein
STRINGPOPTR_0010s12150.11e-161(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.19e-28WOX family protein